PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009141952.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 624aa    MW: 68528.8 Da    PI: 5.14
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009141952.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.81.2e-13183243262
                     XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      e k+  r+++NRe+A+ sRqRKk ++eeLeekvk++ +  ++L  +++    e a+l+++
  XP_009141952.1 183 DEKKKRARLMRNRESAQLSRQRKKHYVEELEEKVKSMHSAITDLNGKISYFMAENAALRQQ 243
                     6779999*****************************************9999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-15181246IPR004827Basic-leucine zipper domain
PfamPF001708.6E-12183244IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.128184244IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-16186244No hitNo description
SuperFamilySSF579596.19E-12186244No hitNo description
CDDcd147045.23E-20188238No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MAESITDEPP PSEFDPLFDQ LHNSSSDQTP IGELMSDLGF PIDADFELTF DGMEDLYLPA  60
EDETFLLPDN GSNQEQFGDF TPESEGSAIF GDTDKNIHRN SESPKDSDDE RTLDQPTPLS  120
SQGSDNRGSD VSEAVDQKVK VEEASATKRK KEDDTSDESR SSKYMRSGEE SAVVTGEEEE  180
EEDEKKKRAR LMRNRESAQL SRQRKKHYVE ELEEKVKSMH SAITDLNGKI SYFMAENAAL  240
RQQLGPPPPP MGMYPPIWMH CPPYMVKQQG GGQVPMIPIP RLKPQNPVKA KSKKSESKTK  300
KVASITFLGL LFCLFLFGAL APVVNVNYGG ISGGAFYGSY RSNYVTDQVY NQHRNRVLDT  360
SRSNERDSVP PGNGSEPLVA SLFVPRNDKL VKIDGNLIIN SILASERALA SESNERKADG  420
VVPKEHSLAL PLPDVGMIED MAKHLVRTKA EKQKALSSGF ADTLKDQIKT KAASGEMQQW  480
FREGVAGPMF SSGMCTEVFQ FDVSSTSGAI IPASAATNVS SEHNKNATDT QRRKNRRTLR  540
GLAIPLPGSE HQRNSSSKEI KPVSSMVVSV LVDPREGGDG DIDGMIGGPK SLSRVFVVVL  600
QDSAKYVTYS CVLPRPGAPH LMTT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1530536QRRKNRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.182270.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0024092e-82AC002409.3 Arabidopsis thaliana chromosome 2 clone T20B5 map CIC11C08, complete sequence.
GenBankAY1362952e-82AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004082e-82BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankCP0026852e-82CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141952.10.0PREDICTED: uncharacterized protein LOC103865853
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLM4DKD00.0M4DKD0_BRARP; Uncharacterized protein
STRINGBra016959.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein